Lineage for d4weka1 (4wek A:295-465)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
unusual foldSuperfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) 
automatically mapped to Pfam PF03717Family d.175.1.0: automated matches [227232] (1 protein)
not a true familyProtein automated matches [226981] (13 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:1163392] [271725] (4 PDB entries) 
Domain d4weka1: 4wek A:295-465 [271726]
Other proteins in same PDB: d4weka2
automated match to d4kqra1
complexed with 3lc
Details for d4weka1
PDB Entry: 4wek (more details), 1.74 Å
PDB Description: crystal structure of pseudomonas aeruginosa pbp3 with a r4 substituted vinyl monocarbam
PDB Compounds: (A:) penicillin-binding protein 3SCOPe Domain Sequences for d4weka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4weka1 d.175.1.0 (A:295-465) automated matches {Pseudomonas aeruginosa [TaxId: 1163392]}
rsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklf
adrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdv
ddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal
SCOPe Domain Coordinates for d4weka1:
Click to download the PDB-style file with coordinates for d4weka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4weka1:
- d4weka1 first appeared in SCOPe 2.05
- d4weka1 appears in SCOPe 2.07
View in 3D
