SCOPe 2.08: Domain d6hgub2: 6hgu B:113-218

Lineage for d6hgub2 (6hgu B:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6hgub2: 6hgu B:113-218 [377018]
   Other proteins in same PDB: d6hgua_, d6hgub1, d6hguh_, d6hgul1
   automated match to d1t66c2
   complexed with epe, gol

Details for d6hgub2

PDB Entry: 6hgu, 1.5 Å

PDB Description: crystal structure of an anti-app-tag fab

PDB Compounds: (B:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgub2:

Sequence; same for both SEQRES and ATOM records:

>d6hgub2 b.1.1.2 (B:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d6hgub2:

• d6hgub2 first appeared in SCOPe 2.07