Lineage for d6hgul2 (6hgu L:113-218)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d6hgul2: 6hgu L:113-218 [377001]
    Other proteins in same PDB: d6hgua_, d6hgub1, d6hguh_, d6hgul1
    automated match to d1t66c2
    complexed with epe, gol

Details for d6hgul2

PDB Entry: 6hgu (more details), 1.5 Å

PDB Description: crystal structure of an anti-app-tag fab
PDB Compounds: (L:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgul2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgul2 b.1.1.2 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d6hgul2 are not available.

Timeline for d6hgul2:

Domains from same chain:
(mouse over for more information)
d6hgul1
Domains from other chains:
(mouse over for more information)
d6hgua_, d6hgub1, d6hgub2, d6hguh_