Lineage for d6l56q_ (6l56 Q:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318422Species Tegillarca granosa [TaxId:220873] [376376] (3 PDB entries)
  8. 2318451Domain d6l56q_: 6l56 Q: [376717]
    automated match to d5wpna_
    complexed with fe, fe2, na

Details for d6l56q_

PDB Entry: 6l56 (more details), 1.85 Å

PDB Description: fe(ii) loaded tegillarca granosa ferritin
PDB Compounds: (Q:) Ferritin

SCOPe Domain Sequences for d6l56q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l56q_ a.25.1.0 (Q:) automated matches {Tegillarca granosa [TaxId: 220873]}
qtqprqnfhveseaginkqinmelyasyvyqsmymyfdrddvalpsfakyfkhnseeere
haeklmkyqnkrggrivlqdiqkpdldewgspleamqttlaleksvnqalldlhkiadkh
gdaqmmdflegeylkeqvdaieeisdhitnlkrvgtglgeymydketms

SCOPe Domain Coordinates for d6l56q_:

Click to download the PDB-style file with coordinates for d6l56q_.
(The format of our PDB-style files is described here.)

Timeline for d6l56q_: