| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
| Protein 2Fe-2S ferredoxin [54294] (17 species) |
| Species Aphanothece sacrum [TaxId:1122] [54297] (1 PDB entry) |
| Domain d1fxid_: 1fxi D: [37667] complexed with fes |
PDB Entry: 1fxi (more details), 2.2 Å
SCOPe Domain Sequences for d1fxid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxid_ d.15.4.1 (D:) 2Fe-2S ferredoxin {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy
Timeline for d1fxid_: