![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (16 species) |
![]() | Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) |
![]() | Domain d1ewyc_: 1ewy C: [37662] Other proteins in same PDB: d1ewya1, d1ewya2, d1ewyb1, d1ewyb2 complexed with fad, fes |
PDB Entry: 1ewy (more details), 2.38 Å
SCOP Domain Sequences for d1ewyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewyc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120} atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq sdqsfldddqieagyvltcvayptsdvviqthkeedly
Timeline for d1ewyc_:
![]() Domains from other chains: (mouse over for more information) d1ewya1, d1ewya2, d1ewyb1, d1ewyb2 |