Lineage for d1ewyc_ (1ewy C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30503Protein 2Fe-2S ferredoxin [54294] (11 species)
  7. 30506Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 30524Domain d1ewyc_: 1ewy C: [37662]
    Other proteins in same PDB: d1ewya1, d1ewya2, d1ewyb1, d1ewyb2

Details for d1ewyc_

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewyc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1ewyc_:

Click to download the PDB-style file with coordinates for d1ewyc_.
(The format of our PDB-style files is described here.)

Timeline for d1ewyc_: