SCOPe 2.07: Domain d6otta1: 6ott A:1-249

Lineage for d6otta1 (6ott A:1-249)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins)
   has slightly different topology than other families do

6. Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)

7. Species Escherichia coli [TaxId:83333] [376540] (1 PDB entry)

8. Domain d6otta1: 6ott A:1-249 [376546]
   Other proteins in same PDB: d6otta2, d6ottb2
   automated match to d1ecfb2
   complexed with mg, n7y

Details for d6otta1

PDB Entry: 6ott, 2.55 Å

PDB Description: structure of purf in complex with ppapp

PDB Compounds: (A:) Amidophosphoribosyltransferase, PurF

SCOPe Domain Sequences for d6otta1:

Sequence; same for both SEQRES and ATOM records:

>d6otta1 d.153.1.1 (A:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli [TaxId: 83333]}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

Timeline for d6otta1:

• d6otta1 is new in SCOPe 2.07-stable
  
• d6otta1 appears in the current release, SCOPe 2.08