Lineage for d1frda_ (1frd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933783Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 2933787Domain d1frda_: 1frd A: [37648]
    complexed with fes

Details for d1frda_

PDB Entry: 1frd (more details), 1.7 Å

PDB Description: molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
PDB Compounds: (A:) heterocyst [2fe-2s] ferredoxin

SCOPe Domain Sequences for d1frda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
sdqiflddeqmgkgfallcvtyprsnctikthqepyla

SCOPe Domain Coordinates for d1frda_:

Click to download the PDB-style file with coordinates for d1frda_.
(The format of our PDB-style files is described here.)

Timeline for d1frda_: