SCOPe 2.07: Domain d6jjpf_: 6jjp F:

Lineage for d6jjpf_ (6jjp F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (9 PDB entries)

8. Domain d6jjpf_: 6jjp F: [376405]
   Other proteins in same PDB: d6jjpb1, d6jjpb2, d6jjpe1, d6jjpe2
   automated match to d5wt9g_
   complexed with bma, fuc, man, nag

Details for d6jjpf_

PDB Entry: 6jjp, 2.9 Å

PDB Description: crystal structure of fab of a pd-1 monoclonal antibody mw11-h317 in complex with pd-1

PDB Compounds: (F:) Programmed cell death protein 1

SCOPe Domain Sequences for d6jjpf_:

Sequence; same for both SEQRES and ATOM records:

>d6jjpf_ b.1.1.1 (F:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
drpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsq
pgqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Timeline for d6jjpf_:

• d6jjpf_ is new in SCOPe 2.07-stable
  
• d6jjpf_ appears in the current release, SCOPe 2.08