![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
![]() | Domain d6jb2a_: 6jb2 A: [376371] Other proteins in same PDB: d6jb2b_ automated match to d4y5vd_ complexed with cl, gol; mutant |
PDB Entry: 6jb2 (more details), 1.5 Å
SCOPe Domain Sequences for d6jb2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jb2a_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} dvqlvesgggsvqaggslrlscaasgstdsieymtwfrqapgkaregvaalythtgntyy tdsvkgrftisqdkaknmaylrmdsvksedtaiytcgatrkavpvrfaldqssydywgqg tqvtvs
Timeline for d6jb2a_: