SCOPe 2.08: Domain d6jb2a_: 6jb2 A:

Lineage for d6jb2a_ (6jb2 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d6jb2a_: 6jb2 A: [376371]
   Other proteins in same PDB: d6jb2b_
   automated match to d4y5vd_
   complexed with cl, gol; mutant

Details for d6jb2a_

PDB Entry: 6jb2, 1.5 Å

PDB Description: crystal structure of nanobody d3-l11 mutant y102a in complex with hen egg-white lysozyme

PDB Compounds: (A:) Nanobody D3-L11

SCOPe Domain Sequences for d6jb2a_:

Sequence; same for both SEQRES and ATOM records:

>d6jb2a_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscaasgstdsieymtwfrqapgkaregvaalythtgntyy
tdsvkgrftisqdkaknmaylrmdsvksedtaiytcgatrkavpvrfaldqssydywgqg
tqvtvs

Timeline for d6jb2a_:

• d6jb2a_ first appeared in SCOPe 2.07