SCOPe 2.08: Domain d6j15b1: 6j15 B:1-113

Lineage for d6j15b1 (6j15 B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6j15b1: 6j15 B:1-113 [376367]
   Other proteins in same PDB: d6j15a2, d6j15b2, d6j15c1, d6j15c2, d6j15d1, d6j15d2, d6j15h2, d6j15l2
   automated match to d2jell1
   complexed with nag

Details for d6j15b1

PDB Entry: 6j15, 2.6 Å

PDB Description: complex structure of gy-5 fab and pd-1

PDB Compounds: (B:) GY-5 light chain Fab

SCOPe Domain Sequences for d6j15b1:

Sequence; same for both SEQRES and ATOM records:

>d6j15b1 b.1.1.1 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dimltqsplslpvslgdqasiscrssqgivhsdgntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyycfqgshvpytfgggtkleikr

Timeline for d6j15b1:

• d6j15b1 first appeared in SCOPe 2.07