Lineage for d6mvab2 (6mva B:160-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998826Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)
  8. 2998898Domain d6mvab2: 6mva B:160-331 [376273]
    Other proteins in same PDB: d6mvaa1, d6mvab1, d6mvac1, d6mvad1
    automated match to d4jnka2
    complexed with d4s, epe, nai, so4

Details for d6mvab2

PDB Entry: 6mva (more details), 2.02 Å

PDB Description: ldha structure in complex with inhibitor 14
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6mvab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mvab2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d6mvab2:

Click to download the PDB-style file with coordinates for d6mvab2.
(The format of our PDB-style files is described here.)

Timeline for d6mvab2: