SCOPe 2.08: Domain d6kmca_: 6kmc A:

Lineage for d6kmca_ (6kmc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein automated matches [190067] (6 species)
   not a true protein

7. Species Streptococcus sp. [TaxId:1320] [255506] (3 PDB entries)

8. Domain d6kmca_: 6kmc A: [376092]
   automated match to d2zw1a_
   complexed with acy; mutant

Details for d6kmca_

PDB Entry: 6kmc, 1.84 Å

PDB Description: crystal structure of a streptococcal protein g b1 mutant

PDB Compounds: (A:) Immunoglobulin G-binding protein G B1

SCOPe Domain Sequences for d6kmca_:

Sequence; same for both SEQRES and ATOM records:

>d6kmca_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1320]}
mdtyklilngktlkgettteavdaahaekvfkhyanehgvhghwtydpetktftvte

Timeline for d6kmca_:

• d6kmca_ first appeared in SCOPe 2.07