PDB entry 6kmc

View 6kmc on RCSB PDB site
Description: Crystal structure of a Streptococcal protein G B1 mutant
Class: immune system
Keywords: Streptococcal protein G B1 Domain, Immunoglobulin binding protein, IMMUNE SYSTEM
Deposited on 2019-07-31, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Immunoglobulin G-binding protein G B1
  Species: Streptococcus sp. 'group G' [TaxId:1320]
  Database cross-references and differences (RAF-indexed):
  • PDB 6KMC (0-56)
  Domains in SCOPe 2.08: d6kmca_
• Chain 'B':
  Compound: Immunoglobulin G-binding protein G B1
  Species: Streptococcus sp. 'group G' [TaxId:1320]
  Database cross-references and differences (RAF-indexed):
  • PDB 6KMC (0-56)
  Domains in SCOPe 2.08: d6kmcb_
• Heterogens: ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6kmcA (A:)
  mdtyklilngktlkgettteavdaahaekvfkhyanehgvhghwtydpetktftvte
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6kmcB (B:)
  mdtyklilngktlkgettteavdaahaekvfkhyanehgvhghwtydpetktftvte