SCOPe 2.08: Domain d6ntyb1: 6nty B:21-100

Lineage for d6ntyb1 (6nty B:21-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d6ntyb1: 6nty B:21-100 [376064]
   Other proteins in same PDB: d6ntya2, d6ntyb2
   automated match to d1d8za_
   complexed with po4

Details for d6ntyb1

PDB Entry: 6nty, 2.1 Å

PDB Description: 2.1 a resolution structure of the musashi-2 (msi2) rna recognition motif 1 (rrm1) domain

PDB Compounds: (B:) RNA-binding protein Musashi homolog 2

SCOPe Domain Sequences for d6ntyb1:

Sequence, based on SEQRES records:

>d6ntyb1 d.58.7.0 (B:21-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlg
qphheldsktidpkvafprr

Sequence, based on observed residues (ATOM records):

>d6ntyb1 d.58.7.0 (B:21-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkmfigglswqtspdslrdyfskfgeirecmvmrdpkrsrgfgfvtfadpasvdkvlgqp
hheldsktidpkvafprr

Timeline for d6ntyb1:

• d6ntyb1 first appeared in SCOPe 2.07