Lineage for d6ntyb1 (6nty B:21-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952562Domain d6ntyb1: 6nty B:21-100 [376064]
    Other proteins in same PDB: d6ntya2, d6ntyb2
    automated match to d1d8za_
    complexed with po4

Details for d6ntyb1

PDB Entry: 6nty (more details), 2.1 Å

PDB Description: 2.1 a resolution structure of the musashi-2 (msi2) rna recognition motif 1 (rrm1) domain
PDB Compounds: (B:) RNA-binding protein Musashi homolog 2

SCOPe Domain Sequences for d6ntyb1:

Sequence, based on SEQRES records: (download)

>d6ntyb1 d.58.7.0 (B:21-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkmfigglswqtspdslrdyfskfgeirecmvmrdpttkrsrgfgfvtfadpasvdkvlg
qphheldsktidpkvafprr

Sequence, based on observed residues (ATOM records): (download)

>d6ntyb1 d.58.7.0 (B:21-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkmfigglswqtspdslrdyfskfgeirecmvmrdpkrsrgfgfvtfadpasvdkvlgqp
hheldsktidpkvafprr

SCOPe Domain Coordinates for d6ntyb1:

Click to download the PDB-style file with coordinates for d6ntyb1.
(The format of our PDB-style files is described here.)

Timeline for d6ntyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ntyb2