SCOPe 2.07: Domain d6rcia1: 6rci A:39-216

Lineage for d6rcia1 (6rci A:39-216)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries)

8. Domain d6rcia1: 6rci A:39-216 [375851]
   Other proteins in same PDB: d6rcia2, d6rcib2
   automated match to d5cy4b_

Details for d6rcia1

PDB Entry: 6rci, 2 Å

PDB Description: crystal structure of rexo2

PDB Compounds: (A:) Oligoribonuclease, mitochondrial

SCOPe Domain Sequences for d6rcia1:

Sequence; same for both SEQRES and ATOM records:

>d6rcia1 c.55.3.0 (A:39-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maqrmvwvdlemtgldiekdqiiemaclitdsdlnilaegpnliikqpdelldsmsdwck
ehhgksgltkavkestitlqqaeyeflsfvrqqtppglcplagnsvhedkkfldkympqf
mkhlhyriidvstvkelcrrwypeeyefapkkaashralddisesikelqfyrnnifk

Timeline for d6rcia1:

• d6rcia1 is new in SCOPe 2.07-stable
  
• d6rcia1 appears in the current release, SCOPe 2.08