Lineage for d6k12a2 (6k12 A:161-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999538Species Babesia microti [TaxId:1133968] [375571] (3 PDB entries)
  8. 2999541Domain d6k12a2: 6k12 A:161-332 [375600]
    Other proteins in same PDB: d6k12a1, d6k12b1, d6k12c1, d6k12d1, d6k12f1
    automated match to d4jnka2

Details for d6k12a2

PDB Entry: 6k12 (more details), 2.79 Å

PDB Description: babesia microti lactate dehydrogenase apo form (bmldh)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k12a2:

Sequence, based on SEQRES records: (download)

>d6k12a2 d.162.1.0 (A:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidt
vfikdmckdvhkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgq
fgidnevflsvpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

Sequence, based on observed residues (ATOM records): (download)

>d6k12a2 d.162.1.0 (A:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknckdvhkk
vtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevflsvpc
vlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

SCOPe Domain Coordinates for d6k12a2:

Click to download the PDB-style file with coordinates for d6k12a2.
(The format of our PDB-style files is described here.)

Timeline for d6k12a2: