Lineage for d1hnwe1 (1hnw E:74-154)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130799Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 130800Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 130801Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 130809Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 130812Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries)
  8. 130816Domain d1hnwe1: 1hnw E:74-154 [37556]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwe1

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1hnwe1:

Click to download the PDB-style file with coordinates for d1hnwe1.
(The format of our PDB-style files is described here.)

Timeline for d1hnwe1: