Lineage for d6jljk_ (6jlj K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631976Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2631977Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 2631978Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2631985Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries)
  8. 2631998Domain d6jljk_: 6jlj K: [375516]
    Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
    automated match to d5h2fk_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljk_

PDB Entry: 6jlj (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d6jljk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jljk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d6jljk_:

Click to download the PDB-style file with coordinates for d6jljk_.
(The format of our PDB-style files is described here.)

Timeline for d6jljk_: