Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries) |
Domain d6jlkj_: 6jlk J: [375397] Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlk (more details), 2.15 Å
SCOPe Domain Sequences for d6jlkj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlkj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d6jlkj_: