Lineage for d6jlkj_ (6jlk J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631775Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2631785Protein automated matches [191002] (3 species)
    not a true protein
  7. 2631793Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries)
  8. 2631806Domain d6jlkj_: 6jlk J: [375397]
    Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_
    automated match to d5ws5j_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlkj_

PDB Entry: 6jlk (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d6jlkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlkj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d6jlkj_:

Click to download the PDB-style file with coordinates for d6jlkj_.
(The format of our PDB-style files is described here.)

Timeline for d6jlkj_: