SCOPe 2.08: Domain d6ibta2: 6ibt A:324-421

Lineage for d6ibta2 (6ibt A:324-421)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
   alpha-galactosidase A

8. Domain d6ibta2: 6ibt A:324-421 [375352]
   Other proteins in same PDB: d6ibta1, d6ibtb1
   automated match to d1r46a1
   complexed with act, edo, h9t, nag, peg, so4

Details for d6ibta2

PDB Entry: 6ibt, 2.04 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with alpha-galactose configured cyclophellitol aziridine me737

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d6ibta2:

Sequence; same for both SEQRES and ATOM records:

>d6ibta2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

Timeline for d6ibta2:

• d6ibta2 first appeared in SCOPe 2.07