![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Melibiase [75020] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries) alpha-galactosidase A |
![]() | Domain d1r46a1: 1r46 A:324-421 [96973] Other proteins in same PDB: d1r46a2, d1r46b2 complexed with edo, nag |
PDB Entry: 1r46 (more details), 3.25 Å
SCOPe Domain Sequences for d1r46a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r46a1 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]} lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf itqllpvkrklgfyewtsrlrshinptgtvllqlentm
Timeline for d1r46a1: