Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Francisella tularensis [TaxId:263] [348987] (3 PDB entries) |
Domain d6igsb_: 6igs B: [374954] automated match to d3acba_ complexed with so4, zn |
PDB Entry: 6igs (more details), 2.16 Å
SCOPe Domain Sequences for d6igsb_:
Sequence, based on SEQRES records: (download)
>d6igsb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 263]} tysaentevyitsqqleqavtrlaeqinqdysgqqvtlvcvlkgsfmffadlvrklridl rtqfitassygsstkssgtvtltetslkeeyvkdkniiiiedivdtghtyhkliegigky npktlkfatllfkparlerdvkldyvcfeiedkfivgygldfdekyrelpyiglik
>d6igsb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 263]} tysaentevyitsqqleqavtrlaeqinqdysgqqvtlvcvlkgsfmffadlvrklridl rtqfitasstvtltetslkeeyvkdkniiiiedivdtghtyhkliegigkynpktlkfat llfkparlerdvkldyvcfeiedkfivgygldfdekyrelpyiglik
Timeline for d6igsb_: