SCOPe 2.08: Domain d6igsb_: 6igs B:

Lineage for d6igsb_ (6igs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Francisella tularensis [TaxId:263] [348987] (3 PDB entries)

8. Domain d6igsb_: 6igs B: [374954]
   automated match to d3acba_
   complexed with so4, zn

Details for d6igsb_

PDB Entry: 6igs, 2.16 Å

PDB Description: crystal structure of hprt from f. tularensis with zinc

PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d6igsb_:

Sequence, based on SEQRES records:

>d6igsb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 263]}
tysaentevyitsqqleqavtrlaeqinqdysgqqvtlvcvlkgsfmffadlvrklridl
rtqfitassygsstkssgtvtltetslkeeyvkdkniiiiedivdtghtyhkliegigky
npktlkfatllfkparlerdvkldyvcfeiedkfivgygldfdekyrelpyiglik

Sequence, based on observed residues (ATOM records):

>d6igsb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 263]}
tysaentevyitsqqleqavtrlaeqinqdysgqqvtlvcvlkgsfmffadlvrklridl
rtqfitasstvtltetslkeeyvkdkniiiiedivdtghtyhkliegigkynpktlkfat
llfkparlerdvkldyvcfeiedkfivgygldfdekyrelpyiglik

Timeline for d6igsb_:

• d6igsb_ first appeared in SCOPe 2.07