Lineage for d6rkaa2 (6rka A:106-224)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583275Species Ureaplasma urealyticum [TaxId:519849] [374759] (5 PDB entries)
  8. 2583295Domain d6rkaa2: 6rka A:106-224 [374874]
    Other proteins in same PDB: d6rkaa4, d6rkac4
    automated match to d5h9ua2
    complexed with atp, po4, sam

Details for d6rkaa2

PDB Entry: 6rka (more details), 2.5 Å

PDB Description: inter-dimeric interface controls function and stability of s- methionine adenosyltransferase from u. urealiticum
PDB Compounds: (A:) Methionine adenosyltransferase

SCOPe Domain Sequences for d6rkaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rkaa2 d.130.1.0 (A:106-224) automated matches {Ureaplasma urealyticum [TaxId: 519849]}
knligagdqgivfgyacdetpqympltsvlahellkeierqrrskefikiqadmksqvsi
dysnstplietmlvsiqhdedydveyfnkkvsaimeqiakkynlntnfkkiinssgrfv

SCOPe Domain Coordinates for d6rkaa2:

Click to download the PDB-style file with coordinates for d6rkaa2.
(The format of our PDB-style files is described here.)

Timeline for d6rkaa2: