Lineage for d6rjsa3 (6rjs A:225-376)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583275Species Ureaplasma urealyticum [TaxId:519849] [374759] (5 PDB entries)
  8. 2583344Domain d6rjsa3: 6rjs A:225-376 [374828]
    Other proteins in same PDB: d6rjsa4, d6rjsd4
    automated match to d5h9ua3

Details for d6rjsa3

PDB Entry: 6rjs (more details), 2.6 Å

PDB Description: inter-dimeric interface controls function and stability of s- methionine adenosyltransferase from u. urealiticum
PDB Compounds: (A:) Methionine adenosyltransferase

SCOPe Domain Sequences for d6rjsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rjsa3 d.130.1.0 (A:225-376) automated matches {Ureaplasma urealyticum [TaxId: 519849]}
iggpigdtgltgrkiivdtyggvghhgggafsgkdptkvdrsasyfarwiaknvvaakla
kqceiqlafaigqpqpvamyvntfntnlidetkifeaikksfnfdiktfindlnlwttky
lpvatyghfgrddldlsweklnkvedliknsk

SCOPe Domain Coordinates for d6rjsa3:

Click to download the PDB-style file with coordinates for d6rjsa3.
(The format of our PDB-style files is described here.)

Timeline for d6rjsa3: