Lineage for d1gcca_ (1gcc A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77601Fold d.10: DNA-binding domain [54170] (1 superfamily)
  4. 77602Superfamily d.10.1: DNA-binding domain [54171] (3 families) (S)
  5. 77610Family d.10.1.2: GCC-box binding domain [54175] (1 protein)
  6. 77611Protein GCC-box binding domain [54176] (1 species)
  7. 77612Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)
  8. 77613Domain d1gcca_: 1gcc A: [37482]

Details for d1gcca_

PDB Entry: 1gcc (more details)

PDB Description: solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure

SCOP Domain Sequences for d1gcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcca_ d.10.1.2 (A:) GCC-box binding domain {Mouse-ear cress (Arabidopsis thaliana)}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

SCOP Domain Coordinates for d1gcca_:

Click to download the PDB-style file with coordinates for d1gcca_.
(The format of our PDB-style files is described here.)

Timeline for d1gcca_: