PDB entry 1gcc

View 1gcc on RCSB PDB site
Description: solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure
Deposited on 1998-03-13, released 1999-03-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1gcca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gccA (A:)
    khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
    lrv