SCOPe 2.08: Domain d6j53a_: 6j53 A:

Lineage for d6j53a_ (6j53 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein automated matches [191082] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries)

8. Domain d6j53a_: 6j53 A: [374588]
   automated match to d5o8ga_
   complexed with amp

Details for d6j53a_

PDB Entry: 6j53, 1.52 Å

PDB Description: crystal structure of human hint1 complexing with atp

PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d6j53a_:

Sequence; same for both SEQRES and ATOM records:

>d6j53a_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d6j53a_:

• d6j53a_ first appeared in SCOPe 2.07