![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein automated matches [191082] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries) |
![]() | Domain d6j53b_: 6j53 B: [374590] automated match to d5o8ga_ complexed with amp |
PDB Entry: 6j53 (more details), 1.52 Å
SCOPe Domain Sequences for d6j53b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j53b_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d6j53b_: