Lineage for d6u0ya_ (6u0y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2997070Species Stenotrophomonas maltophilia [TaxId:522373] [373871] (12 PDB entries)
  8. 2997077Domain d6u0ya_: 6u0y A: [374079]
    automated match to d5evda_
    complexed with edo, zn

Details for d6u0ya_

PDB Entry: 6u0y (more details), 1.7 Å

PDB Description: crystal structure of the metallo-beta-lactamase l1 from stenotrophomonas maltophilia
PDB Compounds: (A:) Putative metallo-beta-lactamase l1 (Beta-lactamase type ii) (Ec 3.5.2.6) (Penicillinase)

SCOPe Domain Sequences for d6u0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u0ya_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
eaplpqlraytvdaswlqpmaplqvadhtwqigtedltallvqtaegavlldggmpqmag
hlldnmklrgvapqdlrlillshahadhagpvaelkrrtgahvaanaetavllarggsnd
lhfgdgityppasadriimdgevvtvggiaftahfmpghtpgstawtwtdtrdgkpvria
yadslsapgyqlkgnpryprliedykrsfatvralpcdllltphpgasnwnyavgskasa
ealtcnayadaaekkfdaqlareta

SCOPe Domain Coordinates for d6u0ya_:

Click to download the PDB-style file with coordinates for d6u0ya_.
(The format of our PDB-style files is described here.)

Timeline for d6u0ya_: