Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d6s53f_: 6s53 F: [374074] Other proteins in same PDB: d6s53c_, d6s53e_, d6s53i_, d6s53k_ automated match to d1ogwa_ complexed with mpd, zn |
PDB Entry: 6s53 (more details), 2.8 Å
SCOPe Domain Sequences for d6s53f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s53f_ d.15.1.1 (F:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d6s53f_: