Lineage for d6pwra_ (6pwr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607746Species Bos taurus [TaxId:9913] [374004] (7 PDB entries)
  8. 2607750Domain d6pwra_: 6pwr A: [374025]
    automated match to d1t8da_
    complexed with ca, man, nag

Details for d6pwra_

PDB Entry: 6pwr (more details), 1.2 Å

PDB Description: crystal structure of the cow c-type carbohydrate-recognition domain of cd23 in the presence of glcnac-beta1-2-man
PDB Compounds: (A:) Fc fragment of IgE receptor II

SCOPe Domain Sequences for d6pwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pwra_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
cntcpeawiyfqkkcyyfgegakkwiqaryacenlhgrlvsihspeeqdfltkranwrgs
wiglrdldiegefiwmdnqpldysnwqpgepndagqgencvmmlgsgkwndafcgselhg
wvcdrlatc

SCOPe Domain Coordinates for d6pwra_:

Click to download the PDB-style file with coordinates for d6pwra_.
(The format of our PDB-style files is described here.)

Timeline for d6pwra_: