Lineage for d6qs9a1 (6qs9 A:4-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730699Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)
  8. 2730724Domain d6qs9a1: 6qs9 A:4-195 [374011]
    automated match to d5id9a1
    complexed with ca, jge

Details for d6qs9a1

PDB Entry: 6qs9 (more details), 2.8 Å

PDB Description: bovine serum albumin in complex with ketoprofen
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d6qs9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qs9a1 a.126.1.0 (A:4-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshagce
kslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpntlc
defkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpkiet
mrekvlassarq

SCOPe Domain Coordinates for d6qs9a1:

Click to download the PDB-style file with coordinates for d6qs9a1.
(The format of our PDB-style files is described here.)

Timeline for d6qs9a1: