| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (10 species) not a true protein |
| Species Bos taurus [TaxId:9913] [374004] (7 PDB entries) |
| Domain d6pwsa_: 6pws A: [374005] automated match to d1t8da_ complexed with ca, mma |
PDB Entry: 6pws (more details), 1 Å
SCOPe Domain Sequences for d6pwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pwsa_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
cntcpeawiyfqkkcyyfgegakkwiqaryacenlhgrlvsihspeeqdfltkranwrgs
wiglrdldiegefiwmdnqpldysnwqpgepndagqgencvmmlgsgkwndafcgselhg
wvcdrlatc
Timeline for d6pwsa_: