Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Platelet factor 4, PF4 [54121] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54123] (6 PDB entries) |
Domain d1rhpc_: 1rhp C: [37379] |
PDB Entry: 1rhp (more details), 2.4 Å
SCOPe Domain Sequences for d1rhpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhpc_ d.9.1.1 (C:) Platelet factor 4, PF4 {Human (Homo sapiens) [TaxId: 9606]} dlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikk lles
Timeline for d1rhpc_: