Lineage for d6ofdc1 (6ofd C:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764758Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2764759Protein automated matches [227090] (1 species)
    not a true protein
  7. 2764760Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)
  8. 2764767Domain d6ofdc1: 6ofd C:8-120 [373641]
    Other proteins in same PDB: d6ofda2, d6ofdb2, d6ofdc2, d6ofdd2
    automated match to d1kbpa1
    complexed with cl, edo, fe, gol, mf1, na, nag, pge, so4, zn

Details for d6ofdc1

PDB Entry: 6ofd (more details), 2.2 Å

PDB Description: the crystal structure of octadecyloxy(naphthalen-1-yl)methylphosphonic acid in complex with red kidney bean purple acid phosphatase
PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6ofdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ofdc1 b.1.12.0 (C:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d6ofdc1:

Click to download the PDB-style file with coordinates for d6ofdc1.
(The format of our PDB-style files is described here.)

Timeline for d6ofdc1: