| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Dodecameric ferritin homolog [47250] (16 species) |
| Species Listeria innocua [TaxId:272626] [373578] (2 PDB entries) |
| Domain d6hvqc_: 6hvq C: [373579] Other proteins in same PDB: d6hvqe_ automated match to d1qgha_ complexed with la |
PDB Entry: 6hvq (more details), 1.9 Å
SCOPe Domain Sequences for d6hvqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvqc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 272626]}
svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegd
dvtndmliafkasidkhiwmfkaflgkaple
Timeline for d6hvqc_: