SCOPe 2.07: Domain d6qmub1: 6qmu B:5-178

Lineage for d6qmub1 (6qmu B:5-178)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d6qmub1: 6qmu B:5-178 [373508]
   Other proteins in same PDB: d6qmua2, d6qmub2
   automated match to d1ngla_
   complexed with zcq

Details for d6qmub1

PDB Entry: 6qmu, 1.98 Å

PDB Description: a tetrahedral boronic acid diester formed by a non-natural amino acid in the ligand pocket of an engineered lipocalin

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d6qmub1:

Sequence; same for both SEQRES and ATOM records:

>d6qmub1 b.60.1.1 (B:5-178) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfhgkwyvvgxagnailredkdpqkmfatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
wvsqnreyfnitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d6qmub1:

• d6qmub1 is new in SCOPe 2.07-stable
  
• d6qmub1 appears in the current release, SCOPe 2.08