SCOPe 2.06: Domain d1fwha_: 1fwh A:

Lineage for d1fwha_ (1fwh A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (28 PDB entries)

8. Domain d1fwha_: 1fwh A: [37336]
   Other proteins in same PDB: d1fwhb_, d1fwhc1, d1fwhc2
   complexed with ni

Details for d1fwha_

PDB Entry: 1fwh, 2 Å

PDB Description: klebsiella aerogenes urease, c319y variant

PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1fwha_:

Sequence; same for both SEQRES and ATOM records:

>d1fwha_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1fwha_:

• d1fwha_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwha_ appears in SCOPe 2.05
  
• d1fwha_ appears in SCOPe 2.07
  
• d1fwha_ appears in the current release, SCOPe 2.08