SCOPe 2.07: Domain d6rr3a2: 6rr3 A:102-258

Lineage for d6rr3a2 (6rr3 A:102-258)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Brucella ovis [TaxId:444178] [373285] (2 PDB entries)

8. Domain d6rr3a2: 6rr3 A:102-258 [373315]
   Other proteins in same PDB: d6rr3a1
   automated match to d2qdxa2
   complexed with fad

Details for d6rr3a2

PDB Entry: 6rr3, 1.69 Å

PDB Description: crystal structure of fad-containing ferredoxin-nadp reductase from brucella ovis

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d6rr3a2:

Sequence; same for both SEQRES and ATOM records:

>d6rr3a2 c.25.1.0 (A:102-258) automated matches {Brucella ovis [TaxId: 444178]}
ydnlkpgkhlwllstgtglapflsiirdlevyerfekvilvhgvrqvaelaytdfisnel
pqdeflgemvknqliyyptvtrepyktrgrltdlirsgqlfkdvglpefnheddrmmlcg
spemlaetkqileergftegsqsepgefviekafvek

Timeline for d6rr3a2:

• d6rr3a2 is new in SCOPe 2.07-stable
  
• d6rr3a2 appears in the current release, SCOPe 2.08