Lineage for d1fwaa_ (1fwa A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536035Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2536036Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2536037Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2536038Protein Urease, gamma-subunit [54113] (4 species)
  7. 2536057Species Klebsiella aerogenes [TaxId:28451] [54114] (28 PDB entries)
  8. 2536061Domain d1fwaa_: 1fwa A: [37329]
    Other proteins in same PDB: d1fwab_, d1fwac1, d1fwac2
    complexed with co3, ni

Details for d1fwaa_

PDB Entry: 1fwa (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 7.5
PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1fwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwaa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1fwaa_:

Click to download the PDB-style file with coordinates for d1fwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fwaa_: