Lineage for d5qs7a_ (5qs7 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378215Family b.2.5.0: automated matches [254271] (1 protein)
    not a true family
  6. 2378216Protein automated matches [254628] (2 species)
    not a true protein
  7. 2378217Species Homo sapiens [TaxId:9606] [371394] (44 PDB entries)
  8. 2378231Domain d5qs7a_: 5qs7 A: [373268]
    automated match to d5bqdb_
    complexed with jmm

Details for d5qs7a_

PDB Entry: 5qs7 (more details), 1.66 Å

PDB Description: pandda analysis group deposition -- crystal structure of human brachyury g177d variant in complex with z32327641
PDB Compounds: (A:) T-box transcription factor T

SCOPe Domain Sequences for d5qs7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qs7a_ b.2.5.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
elrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnh
rwkyvngewvpggkpepqapscvyihpdspnfgahwmkapvsfskvkltnklngggqiml
nslhkyeprihivrvgdpqrmitshcfpetqfiavtayqneeitalkikyn

SCOPe Domain Coordinates for d5qs7a_:

Click to download the PDB-style file with coordinates for d5qs7a_.
(The format of our PDB-style files is described here.)

Timeline for d5qs7a_: