SCOP 1.73: Domain d1e0ga_: 1e0g A:

Lineage for d1e0ga_ (1e0g A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.7: LysM domain [54105] (1 superfamily)
   beta-alpha(2)-beta; antiparallel strands

4. Superfamily d.7.1: LysM domain [54106] (1 family)

5. Family d.7.1.1: LysM domain [54107] (2 proteins)

6. Protein Membrane-bound lytic murein transclycosylase D, MltD [54108] (1 species)

7. Species Escherichia coli [TaxId:562] [54109] (1 PDB entry)

8. Domain d1e0ga_: 1e0g A: [37325]

Details for d1e0ga_

PDB Entry: 1e0g

PDB Description: lysm domain from e.coli mltd

PDB Compounds: (A:) membrane-bound lytic murein transglycosylase d

SCOP Domain Sequences for d1e0ga_:

Sequence; same for both SEQRES and ATOM records:

>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]}
dsityrvrkgdslssiakrhgvnikdvmrwnsdtanlqpgdkltlfvk

Timeline for d1e0ga_:

• d1e0ga_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0ga_ appears in SCOP 1.71
  
• d1e0ga_ appears in SCOP 1.75
  
• d1e0ga_ appears in the current release, SCOPe 2.08