Lineage for d1e0ga_ (1e0g A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597754Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 597755Superfamily d.7.1: LysM domain [54106] (1 family) (S)
  5. 597756Family d.7.1.1: LysM domain [54107] (1 protein)
  6. 597757Protein Membrane-bound lytic murein transclycosylase D, MltD [54108] (1 species)
  7. 597758Species Escherichia coli [TaxId:562] [54109] (1 PDB entry)
  8. 597759Domain d1e0ga_: 1e0g A: [37325]

Details for d1e0ga_

PDB Entry: 1e0g (more details)

PDB Description: lysm domain from e.coli mltd

SCOP Domain Sequences for d1e0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli}
dsityrvrkgdslssiakrhgvnikdvmrwnsdtanlqpgdkltlfvk

SCOP Domain Coordinates for d1e0ga_:

Click to download the PDB-style file with coordinates for d1e0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1e0ga_: