Lineage for d1qm0a_ (1qm0 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.6: Prion-like [54097] (1 superfamily) Superfamily d.6.1: Prion-like [54098] (1 family) 
Family d.6.1.1: Prion-like [54099] (2 proteins) Protein Prion protein domain [54100] (4 species) Species Human (Homo sapiens) [TaxId:9606] [54103] (15 PDB entries) 
Domain d1qm0a_: 1qm0 A: [37317]
Details for d1qm0a_
PDB Entry: 1qm0 (more details)
PDB Description: human prion protein fragment 90-230
SCOP Domain Sequences for d1qm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qm0a_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens)}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr
SCOP Domain Coordinates for d1qm0a_:
Click to download the PDB-style file with coordinates for d1qm0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qm0a_:
- d1qm0a_ first appeared (with stable ids) in SCOP 1.55
- d1qm0a_ appears in SCOP 1.57
- d1qm0a_ appears in SCOP 1.61
- d1qm0a_ appears in the current release, SCOPe 2.08
View in 3D