Lineage for d1e1ga_ (1e1g A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175110Protein Prion protein domain [54100] (14 species)
  7. 2175128Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries)
  8. 2175138Domain d1e1ga_: 1e1g A: [37310]

Details for d1e1ga_

PDB Entry: 1e1g (more details)

PDB Description: human prion protein variant m166v
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1e1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ga_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpvdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr

SCOPe Domain Coordinates for d1e1ga_:

Click to download the PDB-style file with coordinates for d1e1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1e1ga_: