SCOPe 2.03: Domain d1b10a_: 1b10 A:

Lineage for d1b10a_ (1b10 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein Prion protein domain [54100] (13 species)

7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54102] (1 PDB entry)

8. Domain d1b10a_: 1b10 A: [37306]

Details for d1b10a_

PDB Entry: 1b10

PDB Description: solution nmr structure of recombinant syrian hamster prion protein rprp(90-231) , 25 structures

PDB Compounds: (A:) protein (prion protein)

SCOPe Domain Sequences for d1b10a_:

Sequence; same for both SEQRES and ATOM records:

>d1b10a_ d.6.1.1 (A:) Prion protein domain {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg

Timeline for d1b10a_:

• d1b10a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b10a_ appears in SCOPe 2.02
  
• d1b10a_ appears in SCOPe 2.04
  
• d1b10a_ appears in the current release, SCOPe 2.08