Lineage for d1b10a_ (1b10 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29966Fold d.6: Prion protein domain [54097] (1 superfamily)
  4. 29967Superfamily d.6.1: Prion protein domain [54098] (1 family) (S)
  5. 29968Family d.6.1.1: Prion protein domain [54099] (1 protein)
  6. 29969Protein Prion protein domain [54100] (4 species)
  7. 29975Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54102] (1 PDB entry)
  8. 29976Domain d1b10a_: 1b10 A: [37306]

Details for d1b10a_

PDB Entry: 1b10 (more details)

PDB Description: solution nmr structure of recombinant syrian hamster prion protein rprp(90-231) , 25 structures

SCOP Domain Sequences for d1b10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b10a_ d.6.1.1 (A:) Prion protein domain {Golden hamster (Mesocricetus auratus)}
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg

SCOP Domain Coordinates for d1b10a_:

Click to download the PDB-style file with coordinates for d1b10a_.
(The format of our PDB-style files is described here.)

Timeline for d1b10a_: