Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) automatically mapped to Pfam PF01624 |
Family d.75.2.0: automated matches [254200] (1 protein) not a true family |
Protein automated matches [254440] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254937] (3 PDB entries) |
Domain d6i5fa1: 6i5f A:12-116 [372926] Other proteins in same PDB: d6i5fa2, d6i5fa3, d6i5fa4, d6i5fb2, d6i5fb3, d6i5fb4 automated match to d1w7aa4 complexed with adp, gol, so4; mutant |
PDB Entry: 6i5f (more details), 2.6 Å
SCOPe Domain Sequences for d6i5fa1:
Sequence, based on SEQRES records: (download)
>d6i5fa1 d.75.2.0 (A:12-116) automated matches {Escherichia coli [TaxId: 562]} pmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagi pyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
>d6i5fa1 d.75.2.0 (A:12-116) automated matches {Escherichia coli [TaxId: 562]} pmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagi pyhavenylaklvnqgesvaicekvvrivtp
Timeline for d6i5fa1:
View in 3D Domains from other chains: (mouse over for more information) d6i5fb1, d6i5fb2, d6i5fb3, d6i5fb4 |